PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A08G1075
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 408aa    MW: 45923.7 Da    PI: 7.6972
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A08G1075genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
      Gh_A08G1075 14 KGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding47.34.9e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +++eE+ l+v++++ lG++ W+ Ia+ ++ gRt++++k+ w++
      Gh_A08G1075  67 RGTFSQEEENLIVELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-28664IPR009057Homeodomain-like
PROSITE profilePS5129418.926961IPR017930Myb domain
SuperFamilySSF466892.38E-2912108IPR009057Homeodomain-like
SMARTSM007172.7E-131363IPR001005SANT/Myb domain
PfamPF002492.9E-151461IPR001005SANT/Myb domain
CDDcd001674.21E-121761No hitNo description
PROSITE profilePS5129425.78362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2565116IPR009057Homeodomain-like
SMARTSM007173.0E-1366114IPR001005SANT/Myb domain
PfamPF002491.3E-1367111IPR001005SANT/Myb domain
CDDcd001671.36E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQEEENLIVE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQRG  120
IDPVTHKPLS EVENGEDKNK SQHTNSLDML SGASSELKLN TDNLKPGTTL YEQRPTSSIT  180
APAPGYQLEM EGCSSSNNLM TSTTRKDLFL DRFASTATTT NSQPCDFMPH FPVQQLSYAS  240
TNPRLSPWFS QSEFSSISMS TLLPPLTTSP FLSSPIGFNP SVTLPSHTPS MPSFTVNNSY  300
TWGMADCSTS EKEEAPIHLM ETQPDEMKWP EYLNNPLLMA AALQNQAPQS SLYNIEIKSE  360
THCSTNTKSL SNSMWPQNQQ PQQQQEGLQN SDMCAKDIQR LTTAYGHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-29121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.253770.0boll
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475032.10.0PREDICTED: transcription factor MYB86-like
TrEMBLA0A0B0MJE40.0A0A0B0MJE4_G
STRINGPOPTR_0014s10680.11e-169(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.35e-94myb domain protein 55